Loading...
Statistics
Advertisement

FrancineHuot.com
www.francinehuot.com/
Welcome to FrancineHuot.com. Bienvenue sur le site FrancineHuot.com

Francinehuot.com

Advertisement
Conversion Technology Metas Server
Francinehuot.com is hosted in United States / Scottsdale . Francinehuot.com uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Html5, Number of used javascripts: 1. First javascripts: Jquery.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Microsoft-IIS/8.0.

Technologies in use by Francinehuot.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Html5
  • Php

Advertisement

Javascripts

Number of occurences: 1
  • jquery.min.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Microsoft-IIS/8.0

Powered by

  • ASP.NET

Google Analytics ID

  • UA-58256132-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Francinehuot.com

SSL certificate

    • name: /C=US/ST=Arizona/L=Scottsdale/O=Special Domain Services, LLC/CN=*.shr.prod.phx3.secureserver.net
    • subject:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: Special Domain Services, LLC
      • CN: *.shr.prod.phx3.secureserver.net
    • hash: c180a8c3
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: Starfield Technologies, Inc.
      • OU: http://certificates.starfieldtech.com/repository
      • CN: Starfield Secure Certification Authority
      • serialNumber: 10688435
    • version: 2
    • serialNumber: 22200484828310496
    • validFrom: 131014202335Z
    • validTo: 161014202335Z
    • validFrom_time_t: 1381782215
    • validTo_time_t: 1476476615
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.starfieldtech.com/sfs2-17.crl
      • certificatePolicies: Policy: 2.16.840.1.114414.1.7.23.2 CPS: http://certificates.starfieldtech.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.starfieldtech.com/ CA Issuers - URI:http://certificates.starfieldtech.com/repository/sf_intermediate.crt
      • authorityKeyIdentifier: keyid:49:4B:52:27:D1:1B:BC:F2:A1:21:6A:62:7B:51:42:7A:8A:D7:D5:56
      • subjectAltName: DNS:*.shr.prod.phx3.secureserver.net, DNS:shr.prod.phx3.secureserver.net
      • subjectKeyIdentifier: 28:58:0A:93:48:07:20:AD:AD:B5:30:A2:87:09:72:F9:1C:5C:86:1C

Meta - Francinehuot.com

Number of occurences: 2
  • Name:
    Content: text/html; charset=utf-8
  • Name: description
    Content: Welcome to FrancineHuot.com. Bienvenue sur le site FrancineHuot.com

Server / Hosting

  • IP: 50.62.160.219
  • Latitude: 33.61
  • Longitude: -111.89
  • Country: United States
  • City: Scottsdale

Rname

  • ns05.domaincontrol.com
  • ns06.domaincontrol.com
  • smtp.secureserver.net
  • mailstore1.secureserver.net

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 200 OK Cache-Control: private Pragma: no-cache Content-Length: 0 Content-Type: text/html; charset=UTF-8 Expires: Thu, 19 Nov 1981 08:52:00 GMT Server: Microsoft-IIS/8.0 Set-Cookie: PHPSESSID=86ikf7p1eb9g981ne1k5c1kft3; path=/ X-Powered-By: ASP.NET X-Powered-By-Plesk: PleskWin Date: Sat, 30 Apr 2016 23:22:18 GMT

DNS

host: francinehuot.com
  1. class: IN
  2. ttl: 594
  3. type: A
  4. ip: 50.62.160.219
host: francinehuot.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns05.domaincontrol.com
host: francinehuot.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns06.domaincontrol.com
host: francinehuot.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns05.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2014120102
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 3600
host: francinehuot.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: smtp.secureserver.net
host: francinehuot.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mailstore1.secureserver.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.rancinehuot.com, www.fqrancinehuot.com, www.qrancinehuot.com, www.francinehuot.com, www.rancinehuot.com, www.farancinehuot.com, www.arancinehuot.com, www.fyrancinehuot.com, www.yrancinehuot.com, www.ftrancinehuot.com, www.trancinehuot.com, www.fgrancinehuot.com, www.grancinehuot.com, www.fbrancinehuot.com, www.brancinehuot.com, www.fwrancinehuot.com, www.wrancinehuot.com, www.fsrancinehuot.com, www.srancinehuot.com, www.fdrancinehuot.com, www.drancinehuot.com, www.frrancinehuot.com, www.rrancinehuot.com, www.f3rancinehuot.com, www.3rancinehuot.com, www.f4rancinehuot.com, www.4rancinehuot.com, www.fancinehuot.com, www.friancinehuot.com, www.fiancinehuot.com, www.froancinehuot.com, www.foancinehuot.com, www.frlancinehuot.com, www.flancinehuot.com, www.frlancinehuot.com, www.flancinehuot.com, www.fr.ancinehuot.com, www.f.ancinehuot.com, www.frncinehuot.com, www.fraoncinehuot.com, www.froncinehuot.com, www.frapncinehuot.com, www.frpncinehuot.com, www.fra9ncinehuot.com, www.fr9ncinehuot.com, www.francinehuot.com, www.frncinehuot.com, www.fraincinehuot.com, www.frincinehuot.com, www.frauncinehuot.com, www.fruncinehuot.com, www.fracinehuot.com, www.franncinehuot.com, www.francinehuot.com, www.franhcinehuot.com, www.frahcinehuot.com, www.franjcinehuot.com, www.frajcinehuot.com, www.frankcinehuot.com, www.frakcinehuot.com, www.franlcinehuot.com, www.fralcinehuot.com, www.fran cinehuot.com, www.fra cinehuot.com, www.franinehuot.com, www.francdinehuot.com, www.frandinehuot.com, www.francrinehuot.com, www.franrinehuot.com, www.franctinehuot.com, www.frantinehuot.com, www.francvinehuot.com, www.franvinehuot.com, www.francfinehuot.com, www.franfinehuot.com, www.francginehuot.com, www.franginehuot.com, www.franchinehuot.com, www.franhinehuot.com, www.francninehuot.com, www.franninehuot.com, www.francminehuot.com, www.franminehuot.com, www.francjinehuot.com, www.franjinehuot.com, www.francnehuot.com, www.francirnehuot.com, www.francrnehuot.com, www.francifnehuot.com, www.francfnehuot.com, www.francivnehuot.com, www.francvnehuot.com, www.franciknehuot.com, www.francknehuot.com, www.franci,nehuot.com, www.franc,nehuot.com, www.francibnehuot.com, www.francbnehuot.com, www.francignehuot.com, www.francgnehuot.com, www.francitnehuot.com, www.franctnehuot.com, www.franciynehuot.com, www.francynehuot.com, www.franciunehuot.com, www.francunehuot.com, www.francijnehuot.com, www.francjnehuot.com, www.francimnehuot.com, www.francmnehuot.com, www.francinnehuot.com, www.francnnehuot.com, www.franciehuot.com, www.francinnehuot.com, www.francinehuot.com, www.francinhehuot.com, www.francihehuot.com, www.francinjehuot.com, www.francijehuot.com, www.francinkehuot.com, www.francikehuot.com, www.francinlehuot.com, www.francilehuot.com, www.francin ehuot.com, www.franci ehuot.com, www.francinhuot.com, www.francinexhuot.com, www.francinxhuot.com, www.francineshuot.com, www.francinshuot.com, www.francinewhuot.com, www.francinwhuot.com, www.francinerhuot.com, www.francinrhuot.com, www.francinefhuot.com, www.francinfhuot.com, www.francinevhuot.com, www.francinvhuot.com, www.francinechuot.com, www.francinchuot.com, www.francineqhuot.com, www.francinqhuot.com, www.francineahuot.com, www.francinahuot.com, www.francineyhuot.com, www.francinyhuot.com, www.francineuot.com, www.francineheuot.com, www.francineeuot.com, www.francinehduot.com, www.francineduot.com, www.francinehcuot.com, www.francinecuot.com, www.francinehuuot.com, www.francineuuot.com, www.francinehjuot.com, www.francinejuot.com, www.francinehuot.com, www.francineuot.com, www.francinehbuot.com, www.francinebuot.com, www.francinehguot.com, www.francineguot.com,

Other websites we recently analyzed

  1. Ronni Jolles | Painting With Paper Artist
    “Painting with paper” is the best way to express what I do. Paper – in its multitude of colors and textures – is the essence of my work, and subjects come into
    Culver City (United States) - 205.186.183.143
    Server software: Sun-ONE-Web-Server/6.1
    Technology: CSS, Html, Html5, Javascript, SVG, Google Analytics, Wordpress
    Number of Javascript: 9
    Number of meta tags: 4
  2. Siamexim - Thiết bị nhà bếp cao cấp
    Công ty chuyên nhập khẩu và phân phối độc quyền thiết bị nhà bếp, đồ gia dụng cao cấp Thái Lan.
    United States - 31.220.110.35
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery, jQuery UI, Php, Facebook Box
    Number of Javascript: 10
    Number of meta tags: 4
  3. risperdaltardivedyskinesialawsuit.com
    Albuquerque (United States) - 129.121.40.24
    Server software: nginx
    Technology: Html
    Number of meta tags: 1
  4. gns.no
    Norway - 91.221.130.155
    Server software: Apache
    Technology: Html, Php
  5. systemsshopper.com - Diese Website steht zum Verkauf! - Informationen zum Thema computer home audio.
    Diese
    Cambridge (United States) - 72.52.4.119
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, Html, Html5, Javascript, Php
    Number of Javascript: 3
    Number of meta tags: 5
  6. Global Future Ltd.
    Scottsdale (United States) - 184.168.224.170
    Server software: Microsoft-IIS/8.0
    Technology: CSS, Flexslider, Html, Iframe, Javascript
    Number of Javascript: 4
    Number of meta tags: 3
  7. Webdesign Komplettpaket zum Festpreis - für alle Branchen!
    Sie suchen ein Webdesign im Paket zum Komplettpreis? Wählen Sie in nur 3 Schritten Ihr Komplettpaket - für alle Branchen! Professionell & günstig!
    France - 5.196.189.250
    G Analytics ID: UA-20632638-14
    Server software: Apache/2.2.16 (Debian)
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress
    Number of Javascript: 20
    Number of meta tags: 5
  8. ❺❺Iتبادل لینک لحظه ای (رنک 3 گوگل)I❺❺
    ✚تبادل لینک لحظه ای (رنک 3 گوگل)✚✯همین حالا اینجا کلیک کنید و در 5 ثانیه تبادل لینک کنید و سایت یا وبلاگتان را به همه معرفی کنید✯✚تبادل لینک لحظه ای (رنک 3 گوگل)✚
    Los Angeles (United States) - 192.69.200.139
    G Analytics ID: UA-17583324-3
    Server software: squid/3.5.14
    Technology: CSS, Html, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 3
  9. Colerain RV | Cincinnati RV Dealer | Dayton RV Sales | Indianapolis RV Dealer | Delaware RV Dealer
    Colerain RV is here to service all of your camping needs. Located in Cincinnati & Dayton Ohio, & Indianapolis, Indiana, we offer a variety of Travel Trailers, 5th wheels & Motor Homes as well as the largest parts & service department in the Midwest!
    Orlando (United States) - 72.29.69.47
    Server software: Microsoft-IIS/7.5
    Technology: BootstrapCDN, AJAX Libraries API, CSS, Font Awesome, Html, Iframe, Javascript, jQuery, jQuery Cycle, jQuery Fancybox, jQuery UI, Php, SVG, Google Analytics, Google AdWords Conversion Tracking, Google Tagmanager, Facebook Like button, Facebook Box, Twitter Button
    Number of Javascript: 23
    Number of meta tags: 9
  10. The Precise Definition of Reason
    What is Reason? is the most important question a man can ask himself
    United Kingdom - 83.223.106.30
    Server software: Apache
    Technology: CSS, Html
    Number of Javascript: 1
    Number of meta tags: 4

Check Other Websites